Detect epitope amino acids in sequence from BDP file

Tagged: , ,

Viewing 2 reply threads
  • Author
    Posts
    • #117760
      Daniel K
      Participant

      I have a BDP file. It’s id is 4WFF.
      From RCSB website

      Now I have the fasta sequences describing the structures:
      >4WFF_1|Chains A,B|Potassium channel subfamily K member 4|Homo sapiens (9606)
      MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTSNSLEVLFQ
      >4WFF_2|Chains D,F|ANTI-TRAAK ANTIBODY 13E9 FAB FRAGMENT LIGHT CHAIN|Mus musculus (10090)
      QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
      >4WFF_3|Chains E,G|ANTI-TRAAK ANTIBODY 13E9 FAB FRAGMENT HEAVY CHAIN|Mus musculus (10090)
      EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD

      I want to know which part of each sequence is an epitope.
      I tried using IEDB database but with no results.

      Is there any tool or database that can tell the answer?
      I’m not talking about prediction, but on known information.

    • #117765
      Daniel K
      Participant

      I got the PDB file from http://www.rcsb.org/ .

    • #117789
      coca mary
      Participant

      I look forward to seeing your new posts every day. I think many people like your article. Thanks for sharing these remarkable things. Please continue to uphold!
      mapquest directions

Viewing 2 reply threads
  • You must be logged in to reply to this topic.