Viewing 5 reply threads
  • Author
    Posts
    • #14544
      rosegarden
      Participant

      Hey guys, so I’m given a long strand of protein (shown below). It is predicted to be nuclear localized but how can I know that it’s nuclear localized just by looking at its primary sequence? I mean we can probably do some protein tagging to localize it experimentally but I have no idea how the prediction part comes about. Thanks in advance for any help.

      mdkvlnreeslqlmdllglersawgniplmrkaylkkckefhpdkggdeekmkkmntlyk
      kmedgvkyahqpdfggfwdateiptygtdeweqwwnafneenlfcseempssddeatads
      qhstppkkkrkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekys
      vtfisrhnsynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdp
      fsvieeslpgglkehdfnpeeaeetkqvswklvteyametkcddvllllgmylefqysfe
      mclkcikkeqpshykyhekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqm
      ltnrfndlldrmdimfgstgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkr
      ywlfkgpidsgkttlaaallelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtgg
      esrdlpsgqginnldnlrdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqar
      fvkqidfrpkdylkhclersefllekriiqsgialllmliwyrpvaefaqsiqsrivewk
      erldkefslsvyqkmkfnvamgigvldwlrnsddddedsqenadknedggeknmedsghe
      tgidsqsqgsfqapqssqsvhdhnqpyhicrgftcfkkpptpppepet

    • #103583
      canalon
      Participant
    • #103584
      rosegarden
      Participant

      I have used predictor tools but I want to know how to predict localization just by looking at the primary sequence.

    • #103590
      JackBean
      Participant

      but that’s what the predictors do, they look on the primary structure and look for specific patterns, which could mean localisation into any organelle

    • #103598
      rosegarden
      Participant

      does this have something to do with locating a part of the main sequence called the nuclear localization signal with indicates nuclear localization? and if so what is the sequence of the nuclear localization signal?

    • #103604
      JackBean
      Participant
Viewing 5 reply threads
  • You must be logged in to reply to this topic.